From nobody Fri Jul 2 14:36:26 2021 Return-Path: X-Original-To: rum@ietfa.amsl.com Delivered-To: rum@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id D85BB3A0FDE for ; Fri, 2 Jul 2021 14:36:24 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -2.001 X-Spam-Level: X-Spam-Status: No, score=-2.001 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, RCVD_IN_DNSWL_BLOCKED=0.001, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=alum.mit.edu Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id HB9afC7YlQkQ for ; Fri, 2 Jul 2021 14:36:20 -0700 (PDT) Received: from NAM12-DM6-obe.outbound.protection.outlook.com (mail-dm6nam12on2064.outbound.protection.outlook.com [40.107.243.64]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B52333A0EEA for ; Fri, 2 Jul 2021 14:36:20 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=E7r3YFNiJZTn/zDXyVhEtcaZytf4NSG6GUZWvqrE/PwLCwPh5/iqZw3DOZ6Tls4NDP/FCRzGdpDmgnOnSmg64adCVAoMOfD+M6wm6qmDZxihoetIPuj3fKoA2EyCuze/CNMYLGOCAavr0D+T/GDSuN6d+Qw1oWLr9m0vAhNMPnsCfd6ZA4wNV6PdVuNKXXaxp797Qevembl9HLb5TaOH3XBrIW0ddoqzBS9L0/3fzpv5tVkp35QTfJ38uDH2kAYNk0uL30fOT9gVUGjcFFe9uj3BGpBwKKV38Yy8993aik52/0VZOpGlgG2vulV1mgGEGyDDN+/pjVlvr9XBTBuyEg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=LPdpEtc7gtqNYDahnVnLC4mTAZIMt9P3DviJa7ffAeU=; b=RZejLTTrOPVQXNv576WCpjDMBxLv9SIHKeYuqdhrJ6SnFoUWXbp4tK+jvWdWyKBKMFG3p+3xb5ZgA6roxyGw1E1SrJ+jaKDFF61BagcfSwGlc6f954QAsKUvuMWiQmd+4AEP3N9ar9eu+56RzBDg6aMV3AZkQCvGqdDj5Bg/Kb0qei+7SpMdNlLaeX7BUti7/1uI5vtssZQIy0BKz+74INppfWTKuAPECEm/2VBGhCOGAOkILGje6Cr0RoUAP3i5uokIuM9Idlrkgow9pwxXeMCz80kUCi5qZpw6co9ZPnHrCbshhBRN/bbap8BLUpS6euASrFqV39Sa4rQtLFnECg== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass (sender ip is 18.7.68.33) smtp.rcpttodomain=ietf.org smtp.mailfrom=alum.mit.edu; dmarc=bestguesspass action=none header.from=alum.mit.edu; dkim=none (message not signed); arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alum.mit.edu; s=selector2; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=LPdpEtc7gtqNYDahnVnLC4mTAZIMt9P3DviJa7ffAeU=; b=TqNL/f4Cp9joI2Fv5sfBW5wTgD1NlaHYTmefVeSiuobgtb5KV6UR2kW+sBUEjyFvJ+17IS/67hPTnEWU2yvVd3a1q+w9XHMVAnSGi/4Yn44cqhNIk83X8LixM/yJW1ftBKsNkoTzkXDsbU/AURLJ7/jxK0vR7bLke4NA92teUqs= Received: from BN9PR03CA0138.namprd03.prod.outlook.com (2603:10b6:408:fe::23) by SN6PR12MB2845.namprd12.prod.outlook.com (2603:10b6:805:75::33) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4242.19; Fri, 2 Jul 2021 21:36:18 +0000 Received: from BN1NAM02FT049.eop-nam02.prod.protection.outlook.com (2603:10b6:408:fe:cafe::3) by BN9PR03CA0138.outlook.office365.com (2603:10b6:408:fe::23) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4287.21 via Frontend Transport; Fri, 2 Jul 2021 21:36:18 +0000 X-MS-Exchange-Authentication-Results: spf=pass (sender IP is 18.7.68.33) smtp.mailfrom=alum.mit.edu; ietf.org; dkim=none (message not signed) header.d=none;ietf.org; dmarc=bestguesspass action=none header.from=alum.mit.edu; Received-SPF: Pass (protection.outlook.com: domain of alum.mit.edu designates 18.7.68.33 as permitted sender) receiver=protection.outlook.com; client-ip=18.7.68.33; helo=outgoing-alum.mit.edu; Received: from outgoing-alum.mit.edu (18.7.68.33) by BN1NAM02FT049.mail.protection.outlook.com (10.13.2.89) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4287.22 via Frontend Transport; Fri, 2 Jul 2021 21:36:18 +0000 Received: from MacBook-Air.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id 162LaGDB025503 (version=TLSv1/SSLv3 cipher=AES128-GCM-SHA256 bits=128 verify=NOT) for ; Fri, 2 Jul 2021 17:36:17 -0400 To: "rum@ietf.org" From: Paul Kyzivat Message-ID: <6c2364c5-aec2-0f34-2b0e-834e1c5f41d9@alum.mit.edu> Date: Fri, 2 Jul 2021 17:36:16 -0400 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:78.0) Gecko/20100101 Thunderbird/78.11.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-EOPAttributedMessage: 0 X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: 68bd63fa-41f2-47a1-714c-08d93da16d43 X-MS-TrafficTypeDiagnostic: SN6PR12MB2845: X-Microsoft-Antispam-PRVS: X-MS-Oob-TLC-OOBClassifiers: OLM:8882; X-MS-Exchange-SenderADCheck: 1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: 4USYSAv4MgcxjXa5FT2sOI6zn5pWX3mrpkWiyAX/kQo8zDW2USNL7PL0PlS0Lho0MdGFzuAJTXJZe5JIv47+8wC9hL0brgsz4cmq1xOQxCBIGpneZzLfW2QL5D+VGaQMUekw15kbtjEBcUPkkEms6shd1jwLtnYNwOdRTtKwwr2zihdkk+HmnF+cLru4CkbIxWoSJHs59UtBaNG+TaLqmxkWidpQVwNcJxhwLx5UM4hchVgV0LBQhxOQSeZECPZsQQyMmfAxertvp2+xDY5lYmrj4Eb93OTQX/U/3ZWnHau9rox8EHMWbdS/2dNbYGACdIgn/rxUCBoms4wL5e7M2WNBv0EeLOQPvep36q+sM79fwx0JKoaCAK2kR/yAO7j1OASqjH03NyPfDmt27GR1BHELhlRiMTx7JodG9YLhy+GYQlUG/5cx15WlImG9hwC5otMsAsyywXM6Ca8kcnaqjnEOu4IcOdZkv14by6qLbo50Issd1+qXiYu8i53anuqmthErlajnn7Qq4usGemJJkxAweoqpza1VHyZfxRSnSRoYZxWFs0IH55ptqKpgLnyTMJ4qwTeDPYAEKfGDaUNPuwxhBKnrkR6XvhQd6Gl/iHqObAiKTBQzqxY7IqhytfkjmEyIqa2jV6WiXBsCdcEAtqYNveje6BZjLjipcU7d95B4vMZMxxdzBt3TVjib5T7s+Ffk2K2brMEBiI7LpZsqfFEzUW7u/7PkJNcrCndz3mQ= X-Forefront-Antispam-Report: CIP:18.7.68.33; CTRY:US; LANG:en; SCL:1; SRV:; IPV:CAL; SFV:NSPM; H:outgoing-alum.mit.edu; PTR:outgoing-alum.mit.edu; CAT:NONE; SFS:(136003)(39860400002)(346002)(376002)(396003)(36840700001)(46966006)(36860700001)(31686004)(478600001)(86362001)(75432002)(4744005)(356005)(2906002)(82310400003)(47076005)(82740400003)(7596003)(26005)(2616005)(70206006)(36906005)(786003)(186003)(31696002)(5660300002)(956004)(8676002)(8936002)(70586007)(336012)(6916009)(316002)(43740500002); DIR:OUT; SFP:1101; X-OriginatorOrg: alum.mit.edu X-MS-Exchange-CrossTenant-OriginalArrivalTime: 02 Jul 2021 21:36:18.1171 (UTC) X-MS-Exchange-CrossTenant-Network-Message-Id: 68bd63fa-41f2-47a1-714c-08d93da16d43 X-MS-Exchange-CrossTenant-Id: 3326b102-c043-408b-a990-b89e477d582f X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=3326b102-c043-408b-a990-b89e477d582f; Ip=[18.7.68.33]; Helo=[outgoing-alum.mit.edu] X-MS-Exchange-CrossTenant-AuthSource: BN1NAM02FT049.eop-nam02.prod.protection.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Anonymous X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem X-MS-Exchange-Transport-CrossTenantHeadersStamped: SN6PR12MB2845 Archived-At: Subject: [Rum] Call for agenda items for RUM at IETF 111 X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 02 Jul 2021 21:36:25 -0000 RUM fans (RUMmers, RUMees), We've booked a session for RUM at IETF 111, on July 29. There will certainly be an agenda item for Brian to go through the current status of draft-ietf-rum-rue-05. I anticipate a proposal to issue a working group last call on it. If anyone else wants some time, over and above Q&A on the above, to present and discuss points regarding our deliverable, then please comment on this list about it or contact me directly. Thanks, Paul (wearing my chair hat) From nobody Fri Jul 2 15:05:24 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 9A0C93A0A26; Fri, 2 Jul 2021 15:02:56 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: "\"IETF Secretariat\"" To: , Cc: rum@ietf.org, superuser@gmail.com X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162526337661.26814.2790679459822810105@ietfa.amsl.com> Date: Fri, 02 Jul 2021 15:02:56 -0700 Archived-At: Subject: [Rum] rum - Requested session has been scheduled for IETF 111 X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 02 Jul 2021 22:03:07 -0000 Dear Paul Kyzivat, The session(s) that you have requested have been scheduled. Below is the scheduled session information followed by the original request. rum Session 1 (1:00 requested) Thursday, 29 July 2021, Session IV 1630-1730 Room Name: Room 2 size: 502 --------------------------------------------- iCalendar: https://datatracker.ietf.org/meeting/111/sessions/rum.ics Request Information: --------------------------------------------------------- Working Group Name: Relay User Machine Area Name: Applications and Real-Time Area Session Requester: Paul Kyzivat Number of Sessions: 1 Length of Session(s): 1 Hour Number of Attendees: 20 Conflicts to Avoid: People who must be present: Brian Rosen Murray Kucherawy Paul Kyzivat Resources Requested: Special Requests: --------------------------------------------------------- From nobody Thu Jul 8 14:06:18 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 9A2DC3A1CFD; Thu, 8 Jul 2021 14:06:13 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577837362.29251.15156833081062105606@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:06:13 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:06:14 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4966/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:06:43 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id B828A3A1D02; Thu, 8 Jul 2021 14:06:38 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577839874.29251.3151395610916838218@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:06:38 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:06:39 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4997/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:07:15 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id A93383A1D08; Thu, 8 Jul 2021 14:07:10 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577843068.18729.15089998546477179890@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:07:10 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:07:11 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4998/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:07:43 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 8B0D33A1D0A; Thu, 8 Jul 2021 14:07:41 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577846155.25094.17668179032798873634@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:07:41 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:07:42 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4996/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:08:11 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 8F9123A1D11; Thu, 8 Jul 2021 14:08:06 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577848657.14454.10993032506981009140@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:08:06 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:08:07 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4995/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:08:38 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id AD9AF3A1D20; Thu, 8 Jul 2021 14:08:33 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577851370.12574.14025843273236820739@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:08:33 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:08:34 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4999/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:09:27 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id EB6D33A1D2B; Thu, 8 Jul 2021 14:09:24 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577856494.685.10360844922672548969@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:09:24 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:09:25 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4994/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:10:07 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id ADC4A3A1D42; Thu, 8 Jul 2021 14:10:04 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577860470.25094.6179415334420655637@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:10:04 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:10:05 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/5000/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:10:27 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id F27993A1D46; Thu, 8 Jul 2021 14:10:25 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577862598.17357.7635556528801341181@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:10:25 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:10:26 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4993/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:10:51 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 2874E3A1D48; Thu, 8 Jul 2021 14:10:46 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577864615.8336.457341900621557926@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:10:46 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:10:46 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4967/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:11:12 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 6A4293A1D4B; Thu, 8 Jul 2021 14:11:08 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577866842.1836.13622544886895796176@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:11:08 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:11:09 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4968/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:11:31 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id DDB803A1D4F; Thu, 8 Jul 2021 14:11:26 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577868690.17822.3373133850699563979@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:11:26 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:11:27 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4969/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:11:47 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 90DDB3A1D86; Thu, 8 Jul 2021 14:11:42 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577870258.15290.9874444251959863261@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:11:42 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:11:43 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4970/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:12:02 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id C29123A1D59; Thu, 8 Jul 2021 14:11:57 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577871778.15290.12520525318880156707@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:11:57 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:11:58 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4971/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:12:13 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id DB1713A1D60; Thu, 8 Jul 2021 14:12:11 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577873188.23614.7774762386930099813@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:12:11 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:12:12 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4972/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:12:32 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 3A0C23A1D70; Thu, 8 Jul 2021 14:12:27 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577874722.14454.6513617861103293285@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:12:27 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:12:27 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4973/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:12:46 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 8D21F3A1D71; Thu, 8 Jul 2021 14:12:43 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577876356.23622.3760490719882854003@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:12:43 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:12:44 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4974/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:13:02 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 638B93A1D68; Thu, 8 Jul 2021 14:12:58 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577877839.8336.3872253207694090869@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:12:58 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:12:59 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4975/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:13:16 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 4B0A03A1D6C; Thu, 8 Jul 2021 14:13:15 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577879529.8336.15134548500469620342@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:13:15 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:13:15 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4976/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:13:45 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 4B2C63A1D6D; Thu, 8 Jul 2021 14:13:42 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577882230.13964.3247420259602017249@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:13:42 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:13:42 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4977/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:13:59 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id B6D763A1D81; Thu, 8 Jul 2021 14:13:54 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577883474.28536.5740373853499009592@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:13:54 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:13:55 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4978/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:14:17 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 47DBC3A1D7A; Thu, 8 Jul 2021 14:14:13 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577885328.27193.4490574697359459626@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:14:13 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:14:14 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4979/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:14:44 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 3ADAF3A1D89; Thu, 8 Jul 2021 14:14:39 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577887923.17357.17945657918578638632@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:14:39 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:14:39 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4980/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:14:58 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 6BD043A1D8C; Thu, 8 Jul 2021 14:14:56 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577889643.27761.8260254020015466596@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:14:56 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:14:57 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4992/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:15:10 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id E79FD3A1DAD; Thu, 8 Jul 2021 14:14:59 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577889993.12574.11968089322739325898@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:14:59 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:15:02 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4992/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:15:16 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id E68903A1DC5; Thu, 8 Jul 2021 14:15:00 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577890093.11477.1732027214784062571@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:15:00 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:15:06 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4981/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:15:22 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 3219E3A1DE1; Thu, 8 Jul 2021 14:15:09 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577890919.13964.9070854647185832655@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:15:09 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:15:11 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4991/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:15:27 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id DEABC3A1DDA; Thu, 8 Jul 2021 14:15:21 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577892190.17822.4191111361613043488@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:15:21 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:15:23 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4982/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:15:32 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 442C13A1D96; Thu, 8 Jul 2021 14:15:24 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577892427.27761.10213271028768795832@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:15:24 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:15:24 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4990/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:15:42 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id E6CAA3A1DA6; Thu, 8 Jul 2021 14:15:40 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577894093.4382.17298802248686678510@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:15:40 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:15:41 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4983/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:16:05 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 94A5E3A1DA7; Thu, 8 Jul 2021 14:16:00 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577896059.8336.8823731977377467680@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:16:00 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:16:01 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4984/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:16:21 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 545833A1DA3; Thu, 8 Jul 2021 14:16:18 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577897833.24225.14718836972694675659@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:16:18 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:16:18 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4985/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Thu Jul 8 14:16:40 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id E11583A1DAB; Thu, 8 Jul 2021 14:16:34 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: IETF Secretariat To: Cc: ipr-announce@ietf.org, rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.34.0 Auto-Submitted: auto-generated Precedence: bulk Message-ID: <162577899491.18729.15987716481865542946@ietfa.amsl.com> Date: Thu, 08 Jul 2021 14:16:34 -0700 Archived-At: Subject: [Rum] IPR Disclosure Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Jul 2021 21:16:35 -0000 Dear Brian Rosen: An IPR disclosure that pertains to your Internet-Draft entitled "Interoperability Profile for Relay User Equipment" (draft-ietf-rum-rue) was submitted to the IETF Secretariat on 2021-07-08 and has been posted on the "IETF Page of Intellectual Property Rights Disclosures" (https://datatracker.ietf.org/ipr/4986/). The title of the IPR disclosure is "Sorenson IP Holdings LLC's Statement about IPR related to draft-ietf-rum-rue" Thank you IETF Secretariat From nobody Fri Jul 9 12:28:51 2021 Return-Path: X-Original-To: rum@ietfa.amsl.com Delivered-To: rum@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 643D73A2C3A for ; Fri, 9 Jul 2021 12:28:49 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -2.001 X-Spam-Level: X-Spam-Status: No, score=-2.001 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, RCVD_IN_DNSWL_BLOCKED=0.001, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=alum.mit.edu Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 88uMuQQ0zoEw for ; Fri, 9 Jul 2021 12:28:45 -0700 (PDT) Received: from NAM02-BN1-obe.outbound.protection.outlook.com (mail-bn1nam07on2060.outbound.protection.outlook.com [40.107.212.60]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 3C8ED3A2C3B for ; Fri, 9 Jul 2021 12:28:45 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=nSc0gl3jvQske7gMrKEVkKU6nKgJge+Qwtb4R1K87XSFUPbOO+5Egjo0aFoSryLXHDYFx23oQg51xss25uZsWXH80LFQen8YkheiRNb6uqgPYfQT31CD4XsvjsikIgJP4hZ6A+Eqs1zVW6s2zaa2aKlEk5enmRCfMs8TGQu5Z8WfO2pQMpn574UPHM4g+IJZnRaUnUgvLZmmaMzN19+dFPo2FVB/LLK2LpC6/g9pui9ftEfdOwvhKVh2+dMnzBhTVD/pWAWnW+cjuSRWX95MGKHNHRSuZLRotjYpE47Kq4OOQe4TJfxrJMI7cVdPK/OUCMHYK2Qk2ERHBP8BemyGEw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=Ht4TpjrhQgUM5Yz+OpiaaY7/uOeCtLq6aYSJeFGKvqA=; b=Ab0Hxs/F5FKsIsAJIxj2rI4jr9hq6AiLtfZ282TWvcULYsolqnfHqg4LW8a9OnhrArdjxlPnxeUl8hTCVrxoPGM21NLPUOKWEQhlIChHcQjok6yTMCqAGCPQxvAG+TSfFsRGCHO8nKhqF6oH0OYPVb4mQR+wSxjt+I6b1MxmbBBDk+brjJhcMpSu7icMBV+hGu0Cjq8Lf0KqDkgl7mi5wJUYPUADAcBbmDfjMfj2540qfkjlFjYQqmMoTgsYP3sQQAQBZFDgqyWBZwKxRyLyad3ZCyJz+W0P1Kaz+Iak63qVbFfQb0RfEqBbDXrreD5h/WzAh5pzmgRTgkdfeJKu0A== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass (sender ip is 18.7.68.33) smtp.rcpttodomain=brianrosen.net smtp.mailfrom=alum.mit.edu; dmarc=bestguesspass action=none header.from=alum.mit.edu; dkim=none (message not signed); arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alum.mit.edu; s=selector2; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=Ht4TpjrhQgUM5Yz+OpiaaY7/uOeCtLq6aYSJeFGKvqA=; b=MeVLohjT5j6hVMHx8jVAqk1DrAgJ/yLE4g7CDc1RYVAQvefX4vuVM1/Rt6Ub+OFwEkUXRkbhMncWrZeou7qOZgKvLtqWjCrm5ZU8636bFuevTnq0sLyU7bsQsE0US1uXOYzzq26sV1mhIXSGgHj6o0wBnPDMZSLMuDl5h/W53Ec= Received: from BN9PR03CA0897.namprd03.prod.outlook.com (2603:10b6:408:13c::32) by DM6PR12MB3577.namprd12.prod.outlook.com (2603:10b6:5:3a::26) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4287.27; Fri, 9 Jul 2021 19:28:43 +0000 Received: from BN1NAM02FT012.eop-nam02.prod.protection.outlook.com (2603:10b6:408:13c:cafe::9b) by BN9PR03CA0897.outlook.office365.com (2603:10b6:408:13c::32) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4308.20 via Frontend Transport; Fri, 9 Jul 2021 19:28:43 +0000 X-MS-Exchange-Authentication-Results: spf=pass (sender IP is 18.7.68.33) smtp.mailfrom=alum.mit.edu; brianrosen.net; dkim=none (message not signed) header.d=none;brianrosen.net; dmarc=bestguesspass action=none header.from=alum.mit.edu; Received-SPF: Pass (protection.outlook.com: domain of alum.mit.edu designates 18.7.68.33 as permitted sender) receiver=protection.outlook.com; client-ip=18.7.68.33; helo=outgoing-alum.mit.edu; Received: from outgoing-alum.mit.edu (18.7.68.33) by BN1NAM02FT012.mail.protection.outlook.com (10.13.2.130) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4308.20 via Frontend Transport; Fri, 9 Jul 2021 19:28:42 +0000 Received: from MacBook-Air.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id 169JScAg025648 (version=TLSv1/SSLv3 cipher=AES128-GCM-SHA256 bits=128 verify=NOT); Fri, 9 Jul 2021 15:28:41 -0400 To: Brian Rosen From: Paul Kyzivat Cc: "rum@ietf.org" Message-ID: <0995317d-f01f-d195-2bc6-92e8134261d0@alum.mit.edu> Date: Fri, 9 Jul 2021 15:28:37 -0400 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:78.0) Gecko/20100101 Thunderbird/78.11.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-EOPAttributedMessage: 0 X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: 40e85110-bc5b-4514-4a4f-08d9430fc33d X-MS-TrafficTypeDiagnostic: DM6PR12MB3577: X-Microsoft-Antispam-PRVS: X-MS-Oob-TLC-OOBClassifiers: OLM:10000; X-MS-Exchange-SenderADCheck: 1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: +XsHolx9TNX+73JpohrFBhBXBnyAubsG8FogEGOw3MPltvk+hrG+l7X4kADk7YKRV/OuAobAkMUENmGaWfLDdNEw+UTaMbpMkQSHLBeUHWajyuApIhi86vG796TwOeXLrUCHrxWGWCeU1kn8X3+Dbjg3jq/aIEYWcq3ajI/duFlfuf1EAJBGRYnm1opxTo0zZH6/C7n21oV6IxQmmMAGx614YJfVqlbx1qh4Dyx4vefXHL0jvTmoW8vZGlTBduw8oxAttdNTMVpXSH54RwWxzlUJvIVdnk9HPFvY4upLr0ioaL5PZbr/8gimhX7BSiEWB2PGO/9/EFv88ZnthRhj5iDrUziPLVrcATVK5V5peCsOY8tXH/bkuXcoZffsuduWgzHsws7EOovr4gX2KBugYFU1s56YudzwVqw3cwZpk8T3DKua1HhNUblDuZmr8Ginjqv96YI9Yo5niGJRuIf7WXFiH9GNuKpHncT/deXlrD3lnRTujBM4Yr6T33j1/DxjWx3LNy50tli4eDMLzDBnfYzSOK3FGrdvmatnWRbNsEzgGE2TY+lhnLRO7tuAqgYH+AgJarZ/eg+B/5RsYnfUTzWx1LJhrrRIqtiF48zdpqyfpjzHXZgSJAni67esixllJ8n8U1k3DJxvDhhMk8svwV/r6HMv7epkYsZ0vv5pUyGV3i7UanUVcCZ7NQC9LsCPfvdigZscRa7dRGnEPpcgGSt5Gjh6sYZ3nxnwHCpHqnk= X-Forefront-Antispam-Report: CIP:18.7.68.33; CTRY:US; LANG:en; SCL:1; SRV:; IPV:CAL; SFV:NSPM; H:outgoing-alum.mit.edu; PTR:outgoing-alum.mit.edu; CAT:NONE; SFS:(376002)(396003)(39860400002)(136003)(346002)(36840700001)(46966006)(70206006)(186003)(31686004)(8676002)(36906005)(82310400003)(2616005)(7596003)(36860700001)(316002)(75432002)(8936002)(6916009)(478600001)(82740400003)(336012)(956004)(2906002)(31696002)(70586007)(86362001)(83380400001)(47076005)(356005)(786003)(5660300002)(6666004)(26005)(4326008)(43740500002); DIR:OUT; SFP:1101; X-OriginatorOrg: alum.mit.edu X-MS-Exchange-CrossTenant-OriginalArrivalTime: 09 Jul 2021 19:28:42.8110 (UTC) X-MS-Exchange-CrossTenant-Network-Message-Id: 40e85110-bc5b-4514-4a4f-08d9430fc33d X-MS-Exchange-CrossTenant-Id: 3326b102-c043-408b-a990-b89e477d582f X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=3326b102-c043-408b-a990-b89e477d582f; Ip=[18.7.68.33]; Helo=[outgoing-alum.mit.edu] X-MS-Exchange-CrossTenant-AuthSource: BN1NAM02FT012.eop-nam02.prod.protection.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Anonymous X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM6PR12MB3577 Archived-At: Subject: [Rum] Comments on draft-ietf-rum-rue-05 X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 09 Jul 2021 19:28:50 -0000 I reviewed this version in whole, from scratch rather than simply reviewing diffs from prior versions. (I find it helpful to do this now and then to get a fresh holistic view.) It seems to generally in pretty good shape. But I do have several points to consider. Some of these are new while I think I have mentioned with prior versions. * Section 1, Intro: I don't think the following: While there are some accommodations in this document to maximize backwards compatibility with devices and services that conform to this document, ... says quite what you meant. I suggest: While there are some accommodations in this document to maximize backwards compatibility with other devices and services that have been used to provide VRS service, * Section 2, Dial-around call: The definition provided: Dial-around call: A relay call where the subscriber specifies the use of a VRS provider other than the default VRS provider. ... actually describes *outbound dial-around*. Inbound dial-around is also a possibility (though I think rarely used), where the hearing caller chooses the provider. Inbound dial-around isn't discussed in this document. I think that is probably ok since there isn't any obvious special treatment required for the RUE in this case. * Section 2, P2P Call: The definition for P2P Call: Point-to-Point Call (P2P Call): A call between two RUEs, without including a CA. is run in to the preceding definition of FIR. Just a typo. * Section 2, Relay-to-relay call: I think we can remove this definition. The only place it is used is a couple of lines down in the definition of Relay Service. It doesn't affect anything. * Section 2, RUE: I suggest a small tweak to the following: Relay user equipment (RUE): A SIP user agent (UA) enhanced with extra features to support a subscriber in requesting and using relay calls. s/requesting and using/requesting, receiving, and using/ * Section 4, IPv6: Seems like we are lacking any corresponding discussion of support for IPv4/IPv6 in media, and how that correlates with the signaling. If signaling for the two protocols is via separate servers, then perhaps there should be a requirement that the servers support the same IP version for media. This is less critical if ICE is used. But even then there is a question of what goes into the c= lines. * Section 5.1, multiple registrations This section says: Support for multiple simultaneous registrations is OPTIONAL. and then goes on to discuss registration with multiple providers, which is fine. But earlier it said: If the configuration (please refer to Section 11) contains multiple "outbound-proxies", then the RUE MUST use them as specified in [RFC5626] to establish multiple flows. That also requires multiple simultaneous registrations. And that *isn't* optional. To clarify this, I suggest modifying the above statement with: Support by the RUE for simultaneous registrations with multiple providers is OPTIONAL. It might be good to further restructure this section to emphasize the distinctions between these cases: - outbound multiple flows. Provider gets to decide whether to support. If provider configures it then the RUE must do it. - support for multiple concurrent providers by a single RUE. Optional for a RUE. Provider has no say and can't tell it is happening. - multiple RUEs registering concurrently with same provider account. User chooses to do this. Provider can tell and should support but may restrict. * Section 5.2.1, Normal Call Origination: I don't know how to interpret the following: The same exceptions apply, including anonymous calls. Same as what? * Section 5.2.2, title This section is titled "One-Stage Dial-Around Origination" but actually contains instructions for both one- and two-stage dial-around. Either the title should be changed (e.g., to simply "Dial-around") or else split into two sections. * Section 5.2.2, two stage dial around I am confused by the following: In two-stage dial-around, the To URI is the URI of the dial-around Provider and the domain of the URI is the Provider domain from the configuration. Do you mean that the RUE allows the user to choose a dial-around provider from the provider list and then fetches a configuration in order to obtain the frontDoor URI? In that case the URI already has a domain, so setting the domain separately makes no sense. Alternatively, the configuration for the frontDoor could be changed to include a dial string instead of a URI. With that change the above makes sense. In either case this implies that the RUE has a special UI for dial-around where the user *picks* a provider from the provider list. It would be helpful to mention that assumption. Of course the user can simply *dial* the front door of the provider directly or via the address book. But we don't need special procedures for that. * Section 5.2.2, Two-Stage Dial-Around While I think the diagram shown is correct one, I think there is a bug in the message details. The Route header field needs to be changed to: Route: sip:red.example.net This will then cause the RUE to send the request to red as shown, and will cause red to remove the route header as also shown. I think this will cause a need to update the provider profile to cover this case. (I think there was such material in an early draft of the profile but it didn't make it into either official version.) * Section 5.4, phone numbers: By calling out numbers that "can be written as an E.164 formatted phone number", I presume you are calling for certain editing operations to be performed. It would be helpful to be explicit about which edits are expected. I presume you mean filling in missing prefixes - at least the country code and its leading "+". Anything else? IIUC toll free numbers (e.g., 800...) are technically not E.164 numbers. Are they to be treated as E.164 numbers for this purpose? * Section 6.6, todo: I see you have a note here of work still to be done. Did you forget? * Section 8, MWI: I can see making support of video mail optional for providers. However, *if* they record video mail from callers then ISTM support for MWI and retrieval of video mail by RUEs should be required. * Section 9.1, provider selection: I have a nit about this: To allow the user to select a relay service, the RUE MAY obtain, on startup, a list of Providers that provide service in a country. While its likely that the RUE might fetch this list on startup, it isn't limited to that. It can do it any time. So how about: To allow the user to select a relay service, the RUE MAY at any time obtain (typically at startup) a list of Providers that provide service in a country. * Section 9.4, notation I'm unfamiliar with the OpenAPI notation you are using, and I don't find a reference to a specification. Can you please supply a reference? Also, while most of it is self explanatory I am confused about repeated objects. It appears that you assume some of them may be repeated while many probably shouldn't be repeated. For instance, I would expect that signup would be repeated in order to specify alternative language/uri pairs. Similarly for dialAround and helpDesk. I'm looking for some indication (syntactic or comment) that indicates this distinction. * Section 9.4, support of 1-stage dial-around: I see that configuration schema of the one-stage dial-around URI is optional. Is that intended? ISTM that use of this should be user choice, not provider choice. And implementation work to support this is minimal. (It arguably will be slightly more work for the default provider to support forwarding the one-stage dial-around call. I don't see any normative language about that, one way or the other. So that is also needed.) * Section 9.4, configured SIP URIs: There are a couple of SIP URIs in the configuration that are intended to be called: frontDoor and helpDesk. But the document contains no procedures for calling a sip URI - only for calling a dial string. I suggest either change the configuration to contain an E.164 number instead of a URI, or else add some text somewhere to cover calling a SIP URI. * Section 9.4, configuration for subscribers vs non-subscribers Both subscribers and non-subscribers may have reason to fetch a configuration from a provider. There is only one mechanism for both of these cases. I guess that the provider is supposed to distinguish these cases by authentication. A non-subscriber won't have credentials, will be surprised if asked to supply them, and won't know what to respond with. And the provider will want to respond to bad credentials with an error rather than the public subset of configuration info. Hence ISTM there must be some difference in the request to distinguish these cases. There are many ways to resolve this. I suggest that the existing ConfigurationData be split into two different object, with separate requests to retrieve them. One containing the info needed by a subscriber and the other for that needed by a non-subscriber. Then the subscriber data can require credentials while the non-subscriber doesn't. That's it. Thanks, Paul From nobody Tue Jul 13 13:53:23 2021 Return-Path: X-Original-To: rum@ietfa.amsl.com Delivered-To: rum@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id A92823A0C61 for ; Tue, 13 Jul 2021 13:53:21 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -2.001 X-Spam-Level: X-Spam-Status: No, score=-2.001 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=alum.mit.edu Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id EXoYnRZmsYgF for ; Tue, 13 Jul 2021 13:53:17 -0700 (PDT) Received: from NAM11-DM6-obe.outbound.protection.outlook.com (mail-dm6nam11on2088.outbound.protection.outlook.com [40.107.223.88]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 427853A0C5D for ; Tue, 13 Jul 2021 13:53:17 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=ehHPNyO2bJkltQOtDGLULjcWI9X0HPui3x04o9ACAF0jREvsmtefqPdBmw1YfzFzba44ehr6XXCRTGfs/qeAKqL3vVi8XE5505pKVlxPNLpxgDs0TQfAGoeVZC8QVT0wNXL7WRAfG8Gpb3GNzVhF27tb3dPT3t7ovUOmnZcQYimrPBj/d8qbeBriK/L01/HHWThKF+5IcLLeG9tmZYzAhmp3KLSMfM8sx7c0rPr/8dfi6XcXJBQdIccYvcJ5G9veohSiXaqwgsWevqqvtIyAInhnEeyI4HbEjt4VINlG8h6VMKwUqfRXm5QpBvbRCCp0V9F2TEDBZV+E6Of5aWlv+Q== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=L3U8xJl6x9Pda7f/BimU+gZzxnz1vbIXwOXuTK1ZY2A=; b=cSf0mEGjks4KiLiOROd+0YlN2gwSNPHx+vxjpi7+JlHU+lpapHOUxullPicYmBZMmo9DQJ0MRc2AmfpkR/2mc9QX3SxqnMZMSX8cfxpGhftU+5V1GiBJxQRQj6fcvdVBVvbeLSgwLjZ/ZYUyts6QEHpe2Gx/BukPHcLQTgSpJOrbrbiNAJuWP52xSWogOylf22ldsH/EmLgcc2FcYggcW2JUhgDtGZTctMSibclPIPabZVkWjo/cL66J/DzyO5fP89urGN8aSmVV/JUVPOi+7Kky/KA9UlqXKOqhX/vfTcloU+Y3JNkRrpd8EAfNsqj6QC+6HCHZ3zUtihpcUoM4XQ== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass (sender ip is 18.7.68.33) smtp.rcpttodomain=ietf.org smtp.mailfrom=alum.mit.edu; dmarc=bestguesspass action=none header.from=alum.mit.edu; dkim=none (message not signed); arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alum.mit.edu; s=selector2; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=L3U8xJl6x9Pda7f/BimU+gZzxnz1vbIXwOXuTK1ZY2A=; b=S3kIrxoev0gTbgkM3xmdVKQeyT7qZFIWUikSlDIDOsUlt6p+ZTdRsCJXoT3gzHXVkgM5vg49s9jA/es56gFiCDpBF7nUPFqkVRmUz/+XI5DQia2EOHZ92qBFCewOSnDJtJgwiVMRecRN5hQV4P/IjTikLc4SVMeH5hZUrKkQrBI= Received: from SN6PR2101CA0023.namprd21.prod.outlook.com (2603:10b6:805:106::33) by BN8PR12MB2852.namprd12.prod.outlook.com (2603:10b6:408:9a::14) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4308.23; Tue, 13 Jul 2021 20:53:15 +0000 Received: from SN1NAM02FT0063.eop-nam02.prod.protection.outlook.com (2603:10b6:805:106:cafe::b6) by SN6PR2101CA0023.outlook.office365.com (2603:10b6:805:106::33) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4352.3 via Frontend Transport; Tue, 13 Jul 2021 20:53:14 +0000 X-MS-Exchange-Authentication-Results: spf=pass (sender IP is 18.7.68.33) smtp.mailfrom=alum.mit.edu; ietf.org; dkim=none (message not signed) header.d=none;ietf.org; dmarc=bestguesspass action=none header.from=alum.mit.edu; Received-SPF: Pass (protection.outlook.com: domain of alum.mit.edu designates 18.7.68.33 as permitted sender) receiver=protection.outlook.com; client-ip=18.7.68.33; helo=outgoing-alum.mit.edu; Received: from outgoing-alum.mit.edu (18.7.68.33) by SN1NAM02FT0063.mail.protection.outlook.com (10.97.5.98) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4308.20 via Frontend Transport; Tue, 13 Jul 2021 20:53:14 +0000 Received: from MacBook-Air.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id 16DKrCKs017394 (version=TLSv1/SSLv3 cipher=AES128-GCM-SHA256 bits=128 verify=NOT) for ; Tue, 13 Jul 2021 16:53:13 -0400 To: "rum@ietf.org" From: Paul Kyzivat Message-ID: Date: Tue, 13 Jul 2021 16:53:12 -0400 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:78.0) Gecko/20100101 Thunderbird/78.11.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-EOPAttributedMessage: 0 X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: df7348c0-2cbe-48ff-432d-08d946403bee X-MS-TrafficTypeDiagnostic: BN8PR12MB2852: X-Microsoft-Antispam-PRVS: X-MS-Oob-TLC-OOBClassifiers: OLM:8882; X-MS-Exchange-SenderADCheck: 1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: OYd6hLFFayfvTGJDDwn5X9VxU1qyd7RfDAHVaNT5D6WrINwh60JKEWYN5zhtPttJlzWPDyBfqK5bY4laulshY6I9/kjD+FFiH3CmH3ZpaSTsevdSjdJGACoj+PkD9kFVm1C1WoZMLFK4F8JgErHw7U0P1shniM7QGIi8NLY0rtE2S62jf4pz15PhA76uIjQh9OemUGvHRulAWQYRPjLnPSKlcryDTHFrY4VKsmTbMGSIHcpgzjsiSS/fj56v7g1/t8SgZqDR5441TM6U8Eh6/XtVrl7pGKpbwMmA/c3WYOaWcNzFP/o3Wx75UH7dW8jKrD6lA26cx4yiwafaOVxQRgmDJUdKnfNvb3WAwTqXEF0Oz80EXV/bPi1H9+568mviT3MDavst51KWVlU8I0rDvVWSADhIHMSEYGuYY2BJrQpDUYPYPdlqf9DUetBHPoI+iyzcMlfJSwK+J2bxNqvvx2PMJ49IeC4lKuMCy3+TlUHxREYwKcI6ac/kA94SQfSDX1SAow8V6FnKvQwWQ5+OGbirtjbbB42m9cgwW7h9XsyqyNzjq07CwRSKVsLOBrL1ArhRnVf+1IGGR9ekYHQTDI2LfqRJBcJJNgg+QIFkKmqPBsN6lfD00LaLLhA9NuFtsC+RCP1kGdZHHX4vBzlWelUtmkkPxAo9X1o4F2rwvdl/OUNx5FIV3z9WhV8czxEEVtnkQMgsXhmzu5co5+Jc82Pnnv95pSbta1L/2CHheAYSRvYmBEHP6XVN7YOJ/L8sYp5zudpIwIxR3ny0sXhfXdjYsjnRQlaTe4GP0NLab6HotzmiQyeyvkZCrE4GOgRF X-Forefront-Antispam-Report: CIP:18.7.68.33; CTRY:US; LANG:en; SCL:1; SRV:; IPV:CAL; SFV:NSPM; H:outgoing-alum.mit.edu; PTR:outgoing-alum.mit.edu; CAT:NONE; SFS:(346002)(376002)(39860400002)(136003)(396003)(46966006)(36840700001)(26005)(70586007)(36860700001)(4744005)(356005)(82310400003)(75432002)(82740400003)(786003)(478600001)(8676002)(47076005)(956004)(31686004)(316002)(966005)(31696002)(6916009)(7596003)(2616005)(186003)(70206006)(2906002)(336012)(8936002)(5660300002)(86362001)(83380400001)(36906005)(43740500002); DIR:OUT; SFP:1101; X-OriginatorOrg: alum.mit.edu X-MS-Exchange-CrossTenant-OriginalArrivalTime: 13 Jul 2021 20:53:14.5008 (UTC) X-MS-Exchange-CrossTenant-Network-Message-Id: df7348c0-2cbe-48ff-432d-08d946403bee X-MS-Exchange-CrossTenant-Id: 3326b102-c043-408b-a990-b89e477d582f X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=3326b102-c043-408b-a990-b89e477d582f; Ip=[18.7.68.33]; Helo=[outgoing-alum.mit.edu] X-MS-Exchange-CrossTenant-AuthSource: SN1NAM02FT0063.eop-nam02.prod.protection.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Anonymous X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem X-MS-Exchange-Transport-CrossTenantHeadersStamped: BN8PR12MB2852 Archived-At: Subject: [Rum] Preliminary RUM WG agenda for IETF 111 X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 13 Jul 2021 20:53:22 -0000 I've posted a preliminary agenda for the RUM session at IETF 111. You can find it at: https://datatracker.ietf.org/meeting/111/session/rum This session will take place online on Thursday July 29 and 4:30 PM PST. This is a basic agenda. If anyone would like to suggest another topic to consider, or wants to present something, then please post a message to the rum@ietf.org describing what you want. Thanks, Paul From nobody Tue Jul 27 11:51:45 2021 Return-Path: X-Original-To: rum@ietfa.amsl.com Delivered-To: rum@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id E1BC53A0AA9 for ; Tue, 27 Jul 2021 11:51:43 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -2.002 X-Spam-Level: X-Spam-Status: No, score=-2.002 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, RCVD_IN_DNSWL_NONE=-0.0001, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=alum.mit.edu Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id WGnszlls_iE6 for ; Tue, 27 Jul 2021 11:51:41 -0700 (PDT) Received: from NAM12-BN8-obe.outbound.protection.outlook.com (mail-bn8nam12on2046.outbound.protection.outlook.com [40.107.237.46]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 7C7D03A0AA3 for ; Tue, 27 Jul 2021 11:51:41 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=PVOP0Sl2DAR+1UjVEWxlzyArqg24Hp1tdEi89Rsi/R4ZmrMJPHVqTYWd15vZDU3TI42KUKo1eX7qRI57EMwFJTTekrMfRopWcvEMzdQ53IOJXmFuYQuroSx+88jvQERgUtElw4fAxINEsJ3a08vZ3PxvNhqNAhGeF9F63wCnseptrYIvg/yi7LNk6+4UV0oO8qU3LSk6KtS9NDpbwl6qdqhZPSzNsoXAQX9EnZGYSpwHcZj/Gxl4as1HltBEM9ORTIrC0p7QJiOma9vmXGQIf93yGTcXk4QkJ9CviLN3+SxznAR47avMM2Meq43mY76l8XD3+X0lXRxA2MIlBt4bDA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=PTVE5Dz8GYGbCLh5fN0oyzmnlbwbM149EezMiGJVpVs=; b=EVuHDgSPIbV2df5lyzad/2yow5k+597sKNdOXt2QGVYxIMSEWTsVUqosrKHyMXYgTR5Mhae81B3kzrox7HF8IsGvAv6plGTJfiVaJLOiBGuz35rxBoz6rRrks4WUUR0Vau3+wU43y6EAsKA+DZcusoRikPHeAmPEYRoF7wb3iN6bTzmRwHAH0ozM0UPyd7N0zZHdvqYuJSOw4q0Ot35ZFBpbHBo1NHqXp1lKCaIQPmnEzkkjHeS9wkCObHobdlUzxS5KJoOWsh04OsZwGuBV1mCchwCyRxHVsIVvLX0/Wd+G+XBG1xck2PTmb9TJFNozl1gEWNuImszEAs2xugJTIA== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass (sender ip is 18.7.68.33) smtp.rcpttodomain=ietf.org smtp.mailfrom=alum.mit.edu; dmarc=bestguesspass action=none header.from=alum.mit.edu; dkim=none (message not signed); arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alum.mit.edu; s=selector2; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=PTVE5Dz8GYGbCLh5fN0oyzmnlbwbM149EezMiGJVpVs=; b=Vh46cO7ZA8HZcnJSyoGoWyLHF87UuWt7KT6pTGqufy9JkFzbUS437DNC2hJSXw3Q139qV10+K394g9Ljeems570cbEfWb0Tdy4nnP5CmMRE1kqkjFF+abwQBPxI6HOELhk86PrCuUPmcc2gZW3Z2jSXHxjDCdHkDziSIcy/DFtk= Received: from SN4PR0601CA0004.namprd06.prod.outlook.com (2603:10b6:803:2f::14) by MN2PR12MB3597.namprd12.prod.outlook.com (2603:10b6:208:cf::25) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4352.29; Tue, 27 Jul 2021 18:51:39 +0000 Received: from SN1NAM02FT0030.eop-nam02.prod.protection.outlook.com (2603:10b6:803:2f:cafe::a6) by SN4PR0601CA0004.outlook.office365.com (2603:10b6:803:2f::14) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4373.18 via Frontend Transport; Tue, 27 Jul 2021 18:51:39 +0000 X-MS-Exchange-Authentication-Results: spf=pass (sender IP is 18.7.68.33) smtp.mailfrom=alum.mit.edu; ietf.org; dkim=none (message not signed) header.d=none;ietf.org; dmarc=bestguesspass action=none header.from=alum.mit.edu; Received-SPF: Pass (protection.outlook.com: domain of alum.mit.edu designates 18.7.68.33 as permitted sender) receiver=protection.outlook.com; client-ip=18.7.68.33; helo=outgoing-alum.mit.edu; Received: from outgoing-alum.mit.edu (18.7.68.33) by SN1NAM02FT0030.mail.protection.outlook.com (10.97.5.194) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.4352.24 via Frontend Transport; Tue, 27 Jul 2021 18:51:39 +0000 Received: from MacBook-Air.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id 16RIpaWY020624 (version=TLSv1/SSLv3 cipher=AES128-GCM-SHA256 bits=128 verify=NOT) for ; Tue, 27 Jul 2021 14:51:37 -0400 To: "rum@ietf.org" From: Paul Kyzivat Message-ID: <4a835a35-2942-78c9-7b16-a916643d8b3f@alum.mit.edu> Date: Tue, 27 Jul 2021 14:51:35 -0400 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:78.0) Gecko/20100101 Thunderbird/78.12.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-EOPAttributedMessage: 0 X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: ab474297-5b9f-471a-f337-08d9512f914d X-MS-TrafficTypeDiagnostic: MN2PR12MB3597: X-Microsoft-Antispam-PRVS: X-MS-Oob-TLC-OOBClassifiers: OLM:8882; X-MS-Exchange-SenderADCheck: 1 X-MS-Exchange-AntiSpam-Relay: 0 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: JPUzPuUcSVtTuf0DrICbkUd8bJPy+l/fJWCb/4+xHQvRLoj6cZZfeScNFCVswfdFQ5T8nTN2SizcqKdRNqfpwMyfDFq0tQcJYObu/0JQgctgxBL7wowHrFjmxfKf9xEObHEKcE7UarKNluTiiaJx4bISFdEjQ+lHB41jzMdkzhNNYvWzh/Y42KvcgPQPPlOScVdK/o8LDpkAjPzpZi+X9cPpKG5ZbCtA0QMkTQ9D4l72msKSTmhYx6aAVFa6mm0GhaXyJhVlmn49IZkWxgkHmjvHeHjUQQ+wQ9LOkwjJrFwlyAVxWPcXfKh42z6n3ETwytMbKICcsYZ3KvBMed+yL1ad4gorvDTQF39hQ8+wMJonlk38UYMgEhqLjDcFYFNuXpZxbWveHZ5GsqB8VQC/gea1qv8nqaWqvYbhflGb6UrWGxY+08g+40T1/22i27cOllRQcFjDGU2ZlfWe/Jf4MC/7IoylO5JatpG5WWanyxS5uPlo57YN8forvl76sM4DFbeVcS3XU9G/fYepTvjLoL4TVDDNCtW4VwVCiPGCVs9rOV65vjyD/dM/kccRMR71QG6ECkMFflkuMGQ2WufFlVEEIFkXrKAwWw8DLyv2Xbf/zxp1eNWWBu+haCI6xCi3oLn1yApu/8dQw9MLZlv0h/LSHTFYqc/rOc76iCnmxN7mKG+g5zlNJUKF51/AS1gMbEbtoYJPaI2fJdMzicTRiPrQAWUdMVZyeTQ9wRulDWA= X-Forefront-Antispam-Report: CIP:18.7.68.33; CTRY:US; LANG:en; SCL:1; SRV:; IPV:CAL; SFV:NSPM; H:outgoing-alum.mit.edu; PTR:outgoing-alum.mit.edu; CAT:NONE; SFS:(396003)(39860400002)(346002)(376002)(136003)(36840700001)(46966006)(82740400003)(4744005)(82310400003)(786003)(6916009)(356005)(86362001)(36906005)(478600001)(2906002)(336012)(7596003)(8936002)(186003)(31686004)(956004)(2616005)(70206006)(8676002)(70586007)(316002)(5660300002)(26005)(75432002)(31696002)(47076005)(36860700001)(43740500002); DIR:OUT; SFP:1101; X-OriginatorOrg: alum.mit.edu X-MS-Exchange-CrossTenant-OriginalArrivalTime: 27 Jul 2021 18:51:39.0824 (UTC) X-MS-Exchange-CrossTenant-Network-Message-Id: ab474297-5b9f-471a-f337-08d9512f914d X-MS-Exchange-CrossTenant-Id: 3326b102-c043-408b-a990-b89e477d582f X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=3326b102-c043-408b-a990-b89e477d582f; Ip=[18.7.68.33]; Helo=[outgoing-alum.mit.edu] X-MS-Exchange-CrossTenant-AuthSource: SN1NAM02FT0030.eop-nam02.prod.protection.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Anonymous X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem X-MS-Exchange-Transport-CrossTenantHeadersStamped: MN2PR12MB3597 Archived-At: Subject: [Rum] Preparing for the RUM wg meeting Thursday X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 27 Jul 2021 18:51:44 -0000 To those of you (hopefully all of you) planning to attend the RUM session at IETF 111: I'm seeking a couple of volunteers for the meeting: - a notes taker - a Jabber scribe We need people to do these tasks before we can conduct the business of the meeting. If I can get volunteers before the meeting begins then we will save more meeting time for business. Please volunteer. Its not hard. Thanks, Paul From nobody Thu Jul 29 06:48:18 2021 Return-Path: X-Original-To: rum@ietfa.amsl.com Delivered-To: rum@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 9D9653A2363 for ; Thu, 29 Jul 2021 06:48:17 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.232 X-Spam-Level: X-Spam-Status: No, score=-1.232 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, RCVD_IN_DNSWL_BLOCKED=0.001, SPF_HELO_NONE=0.001, SPF_SOFTFAIL=0.665, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=comcastmailservice.net Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 5ZLJ8P5feDtc for ; Thu, 29 Jul 2021 06:48:12 -0700 (PDT) Received: from resqmta-po-07v.sys.comcast.net (resqmta-po-07v.sys.comcast.net [IPv6:2001:558:fe16:19:96:114:154:166]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id CB9583A236B for ; Thu, 29 Jul 2021 06:48:12 -0700 (PDT) Received: from resomta-po-16v.sys.comcast.net ([96.114.154.240]) by resqmta-po-07v.sys.comcast.net with ESMTP id 961ZmPKD2iCWI96OQmkLPk; Thu, 29 Jul 2021 13:48:10 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcastmailservice.net; s=20180828_2048; t=1627566490; bh=y4LoHCsVEySsq4mVk22ac+sMpJoCpBBhNYMzgHfZPBI=; h=Received:Received:From:Subject:To:Message-ID:Date:MIME-Version: Content-Type; b=E54QZbyMox3umeGiXhZ/IRnAVJSoDZNAkPQjGycD3GGsB8pocZbzqfjnMgIJFnSVi udNh+uJeYqEwE9fd0q/kc8cEVKlmEIcviiMvRf4LssgxZAiFhjTRZtUG5qXJvmESmX l1PW4fncJHX/LXt9nZaEh4RvFNkCKYw7kXP/1NowylXojz5nMJcRX2Kn3sIRHhyFUc DTv2jCMsZmXjcVO/0KziczPi+36qBTuIclH9RSvmb2XZkc0EYzrbZTwA6DfhkCk0wx xpQiy3LMMEWU/JnoiE9iJyLciygXLWa0/laeWqnebCCT7XCJ+FTV+VnemsmJkwRkR8 Tgqry8ZGM2HEw== Received: from MacBook-Air.localdomain ([24.62.227.142]) by resomta-po-16v.sys.comcast.net with ESMTPA id 96ONmRta2Qlkw96OPmxtlm; Thu, 29 Jul 2021 13:48:10 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedvtddrheefgddvkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddunecunecujfgurhephffuvffkffgfgggtgfesthejredttdefheenucfhrhhomheprfgruhhlucfmhiiiihhvrghtuceophhkhiiiihhvrghtsegrlhhumhdrmhhithdrvgguuheqnecuggftrfgrthhtvghrnhepgeekjeeutdetvdduieevkedtleefueevudeuueefhedvteehjeevvdefjefffefhnecukfhppedvgedriedvrddvvdejrddugedvnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghlohepofgrtgeuohhokhdqtehirhdrlhhotggrlhguohhmrghinhdpihhnvghtpedvgedriedvrddvvdejrddugedvpdhmrghilhhfrhhomhepphhkhiiiihhvrghtsegrlhhumhdrmhhithdrvgguuhdprhgtphhtthhopehruhhmsehivghtfhdrohhrgh X-Xfinity-VMeta: sc=0.00;st=legit From: Paul Kyzivat To: "rum@ietf.org" Message-ID: <04e1c93c-148c-6597-aca9-e32d135a1704@alum.mit.edu> Date: Thu, 29 Jul 2021 09:48:07 -0400 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:78.0) Gecko/20100101 Thunderbird/78.12.0 MIME-Version: 1.0 Content-Type: text/plain; charset=windows-1252; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit Archived-At: Subject: [Rum] Seeking volunteers for today's RUM session X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 29 Jul 2021 13:48:18 -0000 To those of you (hopefully all of you) planning to attend the RUM session at IETF 111: I'm seeking a couple of volunteers for the meeting: - a notes taker - a Jabber scribe We need people to do these tasks before we can conduct the business of the meeting. If I can get volunteers before the meeting begins then we will save more meeting time for business. Please volunteer. Its not hard: The Jabber scribe only needs to monitor the incoming messages for those asking to be relayed into the room. You don't need a special Jabber client - the chat window on the Meetecho screen does the job. The primary job of the note taker is to record decisions and promised actions. More detail is appreciated but not necessary. Thanks, Paul From nobody Thu Jul 29 09:03:15 2021 Return-Path: X-Original-To: rum@ietf.org Delivered-To: rum@ietfa.amsl.com Received: from ietfa.amsl.com (localhost [IPv6:::1]) by ietfa.amsl.com (Postfix) with ESMTP id 4FCF03A0931; Thu, 29 Jul 2021 09:03:09 -0700 (PDT) MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit From: internet-drafts@ietf.org To: Cc: rum@ietf.org X-Test-IDTracker: no X-IETF-IDTracker: 7.35.0 Auto-Submitted: auto-generated Precedence: bulk Reply-To: rum@ietf.org Message-ID: <162757458910.7361.5864009438823950393@ietfa.amsl.com> Date: Thu, 29 Jul 2021 09:03:09 -0700 Archived-At: Subject: [Rum] I-D Action: draft-ietf-rum-rue-06.txt X-BeenThere: rum@ietf.org X-Mailman-Version: 2.1.29 List-Id: Relay User Machine List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 29 Jul 2021 16:03:09 -0000 A New Internet-Draft is available from the on-line Internet-Drafts directories. This draft is a work item of the Relay User Machine WG of the IETF. Title : Interoperability Profile for Relay User Equipment Author : Brian Rosen Filename : draft-ietf-rum-rue-06.txt Pages : 33 Date : 2021-07-29 Abstract: Video Relay Service (VRS) is a term used to describe a method by which a hearing persons can communicate with deaf/Hard of Hearing user using an interpreter ("Communications Assistant") connected via a videophone to the deaf/HoH user and an audio telephone call to the hearing user. The CA interprets using sign language on the videophone link and voice on the telephone link. Often the interpreters may be supplied by a company or agency termed a "provider" in this document. The provider also provides a video service that allows users to connect video devices to their service, and subsequently to CAs and other deaf/HoH users. It is desirable that the videophones used by the deaf/HoH/H-I user conform to a standard so that any device may be used with any provider and that video calls direct between deaf/HoH users work. This document describes the interface between a videophone and a provider. The IETF datatracker status page for this draft is: https://datatracker.ietf.org/doc/draft-ietf-rum-rue/ There is also an HTML version available at: https://www.ietf.org/archive/id/draft-ietf-rum-rue-06.html A diff from the previous version is available at: https://www.ietf.org/rfcdiff?url2=draft-ietf-rum-rue-06 Internet-Drafts are also available by anonymous FTP at: ftp://ftp.ietf.org/internet-drafts/